Invitrogen™ Human GBP5 (aa 476-586) Control Fragment Recombinant Protein

Product Code. 30211836

Brand: Invitrogen™ RP94338

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (41%), Rat (41%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83024 (PA5-83024. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The guanylate-binding proteins (GBPs) are a family of interferon-induced GTP-binding proteins function in innate immunity against microbial and viral pathogens. In humans, there are seven GBPs from hGBP1 to hGBP7. Human GBP1 and GBP2 have been shown to exhibit antiviral activity as well as being able to regulate the inhibition of proliferation and invasion of endothelial cells in response to interferon (IFN). GBP5 promotes selective NALP3 inflammasome responses to pathogenic bacteria and soluble but not crystalline inflammasome priming agents.

Specifications

• Accession Number: Q96PP8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 115362
• Name: Human GBP5 (aa 476-586) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5330409J06Rik; GBP5; GBP-5; Gbp5a; GBP-TA antigen; GTP-binding protein 5; Guanine nucleotide-binding protein 5; guanylate binding protein 5; guanylate nucleotide binding protein 5; guanylate-binding protein 5; muGBP-5; UNQ2427/PRO4987
• Common Name: GBP5
• Gene Symbol: GBP5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TDQALTETEKKKKEAQVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQQKMQEQQMQEQAAQLSTTFQAQNRSLLSELQHAQRTVNNDDPCVLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining