Invitrogen™ Human GBP3 (aa 540-592) Control Fragment Recombinant Protein

Product Code. 30210257

Brand: Invitrogen™ RP100449

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61062 (PA5-61062. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the guanylate-binding protein (GBP) family. GBPs specifically bind guanine nucleotides (GMP, GDP, and GTP) and contain two of the three consensus motifs found in typical GTP-binding proteins. The encoded protein interacts with a member of the germinal center kinase family. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9H0R5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2635
• Name: Human GBP3 (aa 540-592) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: GBP3; GBP-3; GTP-binding protein 3; guanine nucleotide-binding protein 3; guanylate binding protein 3; guanylate-binding protein 3; guanylate-binding protein 3 delta C; RP4-531M19.1
• Common Name: GBP3
• Gene Symbol: GBP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining