Invitrogen™ Human GBL (aa 149-230) Control Fragment Recombinant Protein

Product Code. 30206837

Brand: Invitrogen™ RP102917

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G-protein beta subunit like (GBL protein) is a novel member of WD-40 protein family. It is a highly conserved cytosolic protein consisting of seven WD-40 repeating motifs. LST8 is a functional component of mTOR signaling complex (TORC1) and positively up-regulates the mTOR pathway. It interacts with the kinase domain of mTOR and stabilizes its interaction with raptor. LST8 participates in regulating cell growth and also in nutrient and growth factor-mediated mTOR signaling to S6K1. Reports suggest up-regulated expression of LST8 due to insulin indicating a possible role of LST8 in intracellular events related to insulin-receptor activation including insulin-stimulated glucose transport and glycogen synthesis. Northern Blot analysis detected a ubiquitous expression of LST8 with highest expression in brain and testis.

Specifications

• Accession Number: Q9BVC4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64223
• Name: Human GBL (aa 149-230) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610033N12Rik; AA409454; AI505104; AI851821; G beta-like protein; G protein beta subunit-like; Gable; GbetaL; GBL; GBL protein; Lst8; Mammalian lethal with SEC13 protein 8; mLST8; mLST8 / mLST8; MTOR associated protein, LST8 homolog; MTOR associated protein, LST8 homolog (S. cerevisiae); POP3; protein GbetaL; Target of rapamycin complex subunit LST8; TORC subunit gable; TORC subunit LST8; TORC subunit WAT1; transducin (beta)-like 4; WAT1
• Common Name: GBL
• Gene Symbol: MLST8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining