Invitrogen™ Human GBGT1 (aa 280-346) Control Fragment Recombinant Protein

Product Code. 30207124

Brand: Invitrogen™ RP101342

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62371 (PA5-62371. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Has lost the ability to synthesize Forssman glycolipid antigen (FORS1/FG. Might have acquired an alternative function in glycosphingolipid metabolism, but it remains to be established. It appears to have drifted more slowly than confirmed pseudogenes in the glycosyltransferase 6 family, suggesting that it has remained under evolutionary pressure.

Specifications

• Accession Number: Q8N5D6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26301
• Name: Human GBGT1 (aa 280-346) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A3GALNT; Fgs; Forssman glycolipid synthase; forssman glycolipid synthase-like protein; forssman glycolipid synthetase; Forssman glycolipid synthetase (FS); FS; Gbgt1; Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1; LOC499764; similar to globoside alpha-1,3-N-acetylgalactosaminyltransferase 1; UNQ2513; UNQ2513/PRO6002
• Common Name: GBGT1
• Gene Symbol: GBGT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining