Invitrogen™ Human GBAS (aa 24-55) Control Fragment Recombinant Protein

Product Code. 30206045

Brand: Invitrogen™ RP103491

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84582 (PA5-84582. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GBAS encodes a protein belonging to the NipSnap family, which is believed to participate in vesicular transport. This protein is primarily found in mitochondria and is involved in oxidative phosphorylation. A non-functional version of this gene is located on the long arm of chromosome 2. Multiple isoforms of this gene have been identified due to alternative splicing. NIPSNAP2 is linked to several diseases such as Phosphoserine Phosphatase Deficiency and Mast Syndrome.

Specifications

• Accession Number: O75323
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2631
• Name: Human GBAS (aa 24-55) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 2; AV006093; GBAS; glioblastoma amplified sequence; glioblastoma-amplified sequence; nipsnap homolog 2; NIPSNAP2; Protein NipSnap homolog 2
• Common Name: GBAS
• Gene Symbol: NIPSNAP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CSLLPRLRTWTSSSNRSREDSWLKSLFVRKVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining