Invitrogen™ Human GATAD1 (aa 126-269) Control Fragment Recombinant Protein

Product Code. 30195713

Brand: Invitrogen™ RP89373

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110704 (PA5-110704. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of some chromatin complex recruited to chromatin sites methylated 'Lys-4' of histone H3 (H3K4me).

Specifications

• Accession Number: Q8WUU5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57798
• Name: Human GATAD1 (aa 126-269) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310031E19Rik; 2810047M21Rik; 8430439A17Rik; 9130430G15Rik; B330017N08Rik; CMD2B; ENSMUSG00000073241; GATA zinc finger domain containing 1; GATA zinc finger domain-containing 1-like protein; GATA zinc finger domain-containing protein 1; GATA zinc finger domain-containing protein 1-like protein; Gatad1; im:7150682; ocular development associated; ocular development-associated gene protein; ODAG; RG083M05.2; RG83M5.2; si:dkey-231l1.7; Unknown (protein for MGC:136582); zgc:136582
• Common Name: GATAD1
• Gene Symbol: GATAD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining