Invitrogen™ Human GAT-1 (aa 148-208) Control Fragment Recombinant Protein

Product Code. 30195342

Brand: Invitrogen™ RP102433

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53045 (PA5-53045. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GAT-1 (SLC6A1) The protein encoded by SLC6A1 is a gamma-aminobutyric acid (GABA) transporter that localizes to the plasma membrane. The encoded protein removes GABA from the synaptic cleft, restoring it to presynaptic terminals.

Specifications

• Accession Number: P30531
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6529
• Name: Human GAT-1 (aa 148-208) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A730043E01; GABA T1; GABA T-1; GABA transporter 1; GABA transporter protein; GABAT1; GABATHG; GABATR; Gabt; GABT1; gamma-aminobutyric acid (GABA-A) transporter 1; GAT1; GAT-1; MAE; SLC6A1; Sodium- and chloride-dependent GABA transporter 1; solute carrier family 6 (neurotransmitter transporter), member 1; solute carrier family 6 (neurotransmitter transporter, GABA), member 1; solute carrier family 6 member 1; XT-1; Xtrp1
• Common Name: GAT-1
• Gene Symbol: SLC6A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNTTNMTSAVVEFWERNMHQMTDGLDKPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining