Invitrogen™ Human GARNL3 (aa 503-598) Control Fragment Recombinant Protein

Product Code. 30201021

Brand: Invitrogen™ RP92970

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54590 (PA5-54590. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GARNL3 is a protein coding gene. Gene ontology (GO) annotation include intracellular membrane-bounded organelle.

Specifications

• Accession Number: Q5VVW2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84253
• Name: Human GARNL3 (aa 503-598) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW120551; bA356B19.1; Garnl3; GTPase activating RANGAP domain-like 3; GTPase activating Rap/RanGAP domain like 3; GTPase activating Rap/RanGAP domain-like 3; GTPase-activating Rap/Ran-GAP domain-like protein 3; RGD1564019
• Common Name: GARNL3
• Gene Symbol: GARNL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLETLDLLVLRADKGKDARLFVFRLSALQKGLEGKQAGKSRSDCRENKLEKTKGCHLYAINTHHS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining