missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GALNT15 (aa 404-515) Control Fragment Recombinant Protein

Product Code. 30212512
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212512

Brand: Invitrogen™ RP90214

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53548 (PA5-53548. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Although it displays a much weaker activity toward all substrates tested compared to GALNT2, it is able to transfer up to seven GalNAc residues to the Muc5AC peptide, suggesting that it can fill vicinal Thr/Ser residues in cooperation with other GALNT proteins. Prefers Muc1a as substrate. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N3T1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 117248
Name Human GALNT15 (aa 404-515) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4631401E18Rik; GALNACT15; GalNAc-T-like protein 2; GALNT13; GALNT15; GALNT7; Galntl2; mpp-GalNAc-T15; PIH5; polypeptide GalNAc transferase 15; polypeptide GalNAc transferase-like protein 2; polypeptide N-acetylgalactosaminyltransferase 13; polypeptide N-acetylgalactosaminyltransferase 15; polypeptide N-acetylgalactosaminyltransferase-like 2; polypeptide N-acetylgalactosaminyltransferase-like protein 2; pp-GalNAc-T15; pp-GaNTase-like protein 2; pregnancy-induced hypertension syndrome-related protein 5; protein-UDP acetylgalactosaminyltransferase-like protein 2; UDP-GalNAc transferase T15; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 2; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 15; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 2; UNQ770/PRO1564
Common Name GALNT15
Gene Symbol GALNT15
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GGSVEILPCSRVGHIYQNQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLANVYPELYPSEPRPSFSGKLHNTGLG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.