Invitrogen™ Human GALNT10 (aa 51-172) Control Fragment Recombinant Protein

Product Code. 30213069

Brand: Invitrogen™ RP89729

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52447 (PA5-52447. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GALNT10 is responsible for encoding a GalNAc polypeptide N-acetylgalactosaminyltransferase enzyme, which plays a crucial role in the synthesis of mucin-type oligosaccharides. The enzyme transfers GalNAc from UDP-GalNAc to either serine or threonine residues of polypeptide acceptors. It has been observed that the protein encoded by this gene may exhibit higher catalytic activity towards glycosylated peptides as compared to non-glycosylated peptides.

Specifications

• Accession Number: Q86SR1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55568
• Name: Human GALNT10 (aa 51-172) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU018154; C330012K04Rik; GalNAc transferase 10; GALNACT10; galNAc-T10; GalNAc-T9; GALNT10; Galnt9; polypeptide GalNAc transferase 10; Polypeptide N-acetylgalactosaminyltransferase 10; PP PPGANTASE10; PPGALNACT10; ppGaNTase; pp-GaNTase 10; PPGANTASE10; protein-UDP acetylgalactosaminyltransferase 10; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 10; UDP-N-acetyl-alpha-D-galactosamine: polypeptide N-acetylgalactosaminyltransferase 9; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10); UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 9
• Common Name: GALNT10
• Gene Symbol: GALNT10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining