Invitrogen™ Human GALK2 (aa 385-457) Control Fragment Recombinant Protein

Product Code. 30181327

Brand: Invitrogen™ RP98118

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83668 (PA5-83668. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a highly efficient N-acetylgalactosamine kinase, which has galactokinase activity when galactose is present at high concentrations. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q01415
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2585
• Name: Human GALK2 (aa 385-457) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810017M24Rik; AI327030; Galactokinase 2; GALK2; GalNAc kinase; Gk2; N-acetylgalactosamine kinase
• Common Name: GALK2
• Gene Symbol: GALK2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining