Invitrogen™ Human Galectin 10 (aa 27-103) Control Fragment Recombinant Protein

Product Code. 30182668

Brand: Invitrogen™ RP98386

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59708 (PA5-59708. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulates immune responses through the recognition of cell-surface glycans. Essential for the anergy and suppressive function of CD25-positive regulatory T-cells (Treg).

Specifications

• Accession Number: Q05315
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1178
• Name: Human Galectin 10 (aa 27-103) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Charcot-Leyden crystal galectin; Charcot-Leyden crystal protein; CLC; EC 3.1.1.5; Eosinophil lysophospholipase; GAL10; Gal-10; galectin 10; galectin-10; lectin, galactoside-binding, soluble, 10; LGALS10; LGALS10A; LPPL_HUMAN; lysolecithin acylhydrolase; MGC149659
• Common Name: Galectin 10
• Gene Symbol: CLC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining