Invitrogen™ Human GAL3ST4 (aa 313-395) Control Fragment Recombinant Protein

Product Code. 30210292

Brand: Invitrogen™ RP95729

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58262 (PA5-58262. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the transfer of sulfate to beta-1,3-linked galactose residues in O-linked glycoproteins. Good substrates include asialofetuin, Gal-beta-1,3-GalNAc and Gal-beta-1,3 (GlcNAc-beta-1,6)GalNAc.

Specifications

• Accession Number: Q96RP7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79690
• Name: Human GAL3ST4 (aa 313-395) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500031A01Rik; beta-galactose-3-O-sulfotransferase; Beta-galactose-3-O-sulfotransferase 4; beta-galactose-3-O-sulfotransferase, 4; GAL3ST4; Gal3ST-4; Galactose-3-O-sulfotransferase 4; gal-beta-1,3-GalNAc 3'-sulfotransferase; galbeta1-3 GalNAc 3'-sulfotransferase; PP6968; RGD1561105
• Common Name: GAL3ST4
• Gene Symbol: GAL3ST4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLADALCWGLDDVVGFMHNAQAGHKQGLSTVSNSGLTAEDRQLTARARAWNNLDWALYVHFNRSLWARIEKYGQGRLQTAVAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining