Invitrogen™ Human GADL1 (aa 218-270) Control Fragment Recombinant Protein

Product Code. 30196269

Brand: Invitrogen™ RP96350

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59111 (PA5-59111. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GADL1 belongs to the group II decarboxylase family.

Specifications

• Accession Number: Q6ZQY3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 339896
• Name: Human GADL1 (aa 218-270) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110027M19Rik; Acidic amino acid decarboxylase GADL1; ADC; Aspartate 1-decarboxylase; CSADC; Cysteine sulfinic acid decarboxylase; GADL1; glutamate decarboxylase like 1; glutamate decarboxylase-like 1; glutamate decarboxylase-like protein 1; HuADC; HuCSADC; RGD1565145
• Common Name: GADL1
• Gene Symbol: GADL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGAAPFLVC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining