missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GADD45GIP1 (aa 84-117) Control Fragment Recombinant Protein

Product Code. 30209579
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209579

Brand: Invitrogen™ RP103584

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-111409 (PA5-111409, PA5-64199 (PA5-64199. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Inhibitor of nuclear factor kappa-B kinase subunit beta (IKK beta) is a serine kinase that plays an essential role in the NF-kaapa-B signaling pathway which is activated by mulitple stimuli such as inflammatory cytokines, bacterial, or viral products, DNA damages, or other cellular stresses. IKK beta acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. These modifications allow polyubiquitination of the inhibitors and subsequent degradation by the proteasome. In turn, free NF-kappa-B is translocated into the nucleus and activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Mutations affecting the IKK beta gene can result in Immunodeficiency 15 (IMD15).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TAE8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 90480
Name Human GADD45GIP1 (aa 84-117) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310040G17Rik; 39 S ribosomal protein L59, mitochondrial; AI425883; CKBBP2; CKbetaBP2; CKII beta binding protein 2; CKII beta-associating protein; CR6 interacting factor 1; CR6-interacting factor 1; CRIF1; GADD45G interacting protein 1; GADD45GIP1; growth arrest- and DNA damage-inducible GADD45G-interacting protein; Growth arrest and DNA damage-inducible proteins-interacting protein 1; growth arrest and DNA-damage-inducible proteins-interacting protein 1; growth arrest and DNA-damage-inducible, gamma interacting protein 1; Mitochondrial large ribosomal subunit protein mL64; Mrpl59; MRP-L59; p53-responsive gene 6 protein; papillomavirus L2 interacting nuclear protein 1; Papillomavirus L2-interacting nuclear protein 1; PLINP; PLINP1; PLINP-1; PRG6
Common Name GADD45GIP1
Gene Symbol Gadd45gip1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.