missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GADD45B (aa 22-154) Control Fragment Recombinant Protein

Product Code. 30211822
Click to view available options
Quantity:
100 μL
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30211822

Marque: Invitrogen™ RP90634

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56268 (PA5-56268. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cellcycle progression issubject to arrest at G1 and G2 checkpointsin response to DNA damage, presumablyto allow time for DNA repair prior to entryinto S andMphase, respectively. The p53 tumorsuppressor isrequired for one such G1 checkpoint and functionsto upregulate expression of GADD 45 and p21. GADD 45 binds both Cdks and PCNA, a protein involved in DNA replication and repair. GADD 45 stimulates DNA excision repair in vitro and inhibits entry ofcellsinto S phase. Thus, it has been suggested that GADD 45 mayserve as a link between the p53-dependentcellcycle checkpoint and DNA repair. GADD 45-like proteins, GADD 45 beta and GADD 45 gamma, have been shown to be induced by environmentalstresses. GADD 45 beta and GADD 45 gamma are thought to induce p38/JNK activation via MEKK4 activation.
TRUSTED_SUSTAINABILITY

Spécification

Accession Number O75293
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4616
Name Human GADD45B (aa 22-154) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI323528; DKFZP566B133; Gadd45b; GADD45BETA; growth arrest and DNA damage inducible beta; growth arrest and DNA damage-inducible protein GADD45 beta; growth arrest and DNA-damage-inducible 45 beta; growth arrest and DNA-damage-inducible protein GADD45 beta; growth arrest and DNA-damage-inducible, beta; MYD118; myeloid differentiation primary response; myeloid differentiation primary response gene 118; myeloid differentiation primary response protein MyD118; Negative growth regulatory protein MyD118; Unknown (protein for MGC:138134)
Common Name GADD45B
Gene Symbol GADD45B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis