missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GADD34 (aa 392-506) Control Fragment Recombinant Protein

Product Code. 30194386
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30194386 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30194386 Supplier Invitrogen™ Supplier No. RP92090

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The induction of this gene by ionizing radiation occurs in certain cell lines regardless of p53 status, and its protein response is correlated with apoptosis following ionizing radiation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75807
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23645
Name Human GADD34 (aa 392-506) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9630030H21; Gadd34; growth arrest and DNA damage-inducible protein GADD34; growth arrest and DNA-damage-inducible 34; Myd116; myeloid differentiation primary response gene 116; myeloid differentiation primary response protein MyD116; Myeloid differentiation primary response protein MyD116 homolog; Peg3; PEG-3; PPP1R15A; PR15A; Progression elevated gene 3 protein; protein phosphatase 1 regulatory subunit 15 A; protein phosphatase 1, regulatory (inhibitor) subunit 15 A; protein phosphatase 1, regulatory subunit 15 A; RGD1624209
Common Name GADD34
Gene Symbol PPP1R15A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.