missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GABRE Control Fragment Recombinant Protein

Product Code. 30202290
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202290

Brand: Invitrogen™ RP95438

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61124 (PA5-61124. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants have been identified, but only one is thought to encode a protein.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P78334
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2564
Name Human GABRE Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias GABA(A) mu Receptor; GABA(A) receptor; GABA(A) receptor subunit epsilon; GABA(A) receptor, epsilon; GABRE; gamma-aminobutyric acid; gamma-aminobutyric acid A receptor, epsilon; gamma-aminobutyric acid (GABA) A receptor, epsilon; gamma-aminobutyric acid (GABA) A receptor, subunit epsilon; gamma-aminobutyric acid (GABA-A) receptor, subunit epsilon; gamma-aminobutyric acid A receptor, epsilon; gamma-aminobutyric acid receptor subunit epsilon; gamma-aminobutyric acid type A receptor epsilon subunit; gamma-aminobutyric acid type A receptor subunit epsilon
Common Name GABRE
Gene Symbol Gabre
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.