Invitrogen™ Human GABRB2 (aa 407-466) Control Fragment Recombinant Protein

Product Code. 30196204

Brand: Invitrogen™ RP104086

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64331 (PA5-64331. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GAD-65 and GAD-67, glutamate decarboxylases, function to catalyze the production of GABA (gamma-aminobutyric acid). In the central nervous system GABA functions as the main inhibitory transmitter by increasing a Cl- conductance that inhibits neuronal firing. GABA has been shown to activate both ionotropic (GABAA) and metabotropic (GABAB) receptors as well as a third class of receptors called GABAC. Both GABAA and GABAC are ligand-gated ion channels, however, they are structurally and functionally distinct. Members of the GABAA receptor family include GABAA Rα1-6, GABAA R β1-3, GABAA Rγ1-3, GABAA Rδ, GABAA Rε, GABAA Rρ1 and GABAA Rρ2. The GABAB family is composed of GABAB R1α and GABAB R1β. GABA transporters have also been identified and include GABA T-1, GABA T-2 and GABA T-3 (also designated GAT-1, -2, and -3). The GABA transporters function to terminate GABA action.

Specifications

• Accession Number: P47870
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2561
• Name: Human GABRB2 (aa 407-466) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI834970; C030002O17Rik; C030021G16Rik; GABA(A) receptor subunit beta-2; GABAARbeta2; Gabrab2; GABRB2; Gabrb-2; gamma-aminobutyric acid; gamma-aminobutyric acid (GABA) A receptor, beta 2; gamma-aminobutyric acid (GABA) A receptor, subunit beta 2; gamma-aminobutyric acid (GABA-A) receptor, subunit beta 2; gamma-aminobutyric acid A receptor beta 2; gamma-aminobutyric acid A receptor, subunit beta 2; Gamma-aminobutyric acid receptor beta 2; gamma-aminobutyric acid receptor beta-2 subunit; gamma-aminobutyric acid receptor subunit beta-2; gamma-aminobutyric acid receptor, subunit beta 2; gamma-aminobutyric acid type A receptor beta2 subunit; GARB2; MGC119386; MGC119388; MGC119389
• Common Name: GABRB2
• Gene Symbol: GABRB2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining