missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211852

Invitrogen™ Human GABRA3 (aa 6-125) Control Fragment Recombinant Protein

Product Code. 30211852
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211852

Brand: Invitrogen™ RP91881

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P34903
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2556
Name Human GABRA3 (aa 6-125) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias GABA(A) receptor; GABA(A) receptor subunit alpha-3; GABA(A) receptor, alpha 3; GABA-A receptor alpha-3 subunit; Gabra3; Gabra-3; gamma-aminobutyric acid; gamma-aminobutyric acid (GABA) A receptor, alpha 3; gamma-aminobutyric acid (GABA) A receptor, subunit alpha 3; gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 3; gamma-aminobutyric acid receptor subunit alpha-3; gamma-aminobutyric acid receptor, subunit alpha 3; gamma-aminobutyric acid type A receptor alpha3 subunit; gamma-aminobutyric acid type A receptor subunit alpha3; Gamma-animobutyric acid (GABA) A receptor alpha 3; gamma-animobutyric acid (GABA) A receptor, alpha 3; LOW QUALITY PROTEIN: gamma-aminobutyric acid receptor subunit alpha-3; gamma-aminobutyric acid type A receptor subunit alpha3; MGC33793; unnamed protein product
Common Name GABRA3
Gene Symbol Gabra3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.