missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196964

Invitrogen™ Human GABBR2 (aa 183-323) Control Fragment Recombinant Protein

Product Code. 30196964
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196964

Brand: Invitrogen™ RP90866

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The multi-pass membrane protein, GABBR2, belongs to the G-protein coupled receptor 3 family and GABA-B receptor subfamily. The GABA-B receptors inhibit neuronal activity through G protein-coupled second-messenger systems, which regulate the release of neurotransmitters, and the activity of ion channels and adenylyl cyclase. This receptor subunit forms an active heterodimeric complex with GABA-B receptor subunit 1, neither of which is effective on its own. Allelic variants of this gene have been associated with nicotine dependence.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75899
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9568
Name Human GABBR2 (aa 183-323) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FLJ36928; G protein-coupled receptor 51; GABA BR; GABA-B R2 receptor; GABA-B receptor 2; GABA-B receptor, R2 subunit; GABABR2; GABA-BR2; GABA-B-R2; Gabbr2; gamma-aminobutyric acid; gamma-aminobutyric acid (GABA) B receptor 2; gamma-aminobutyric acid (GABA) B receptor, 2; gamma-aminobutyric acid B receptor 2; gamma-aminobutyric acid type B receptor subunit 2; gamma-aminobutyric acid type B receptor, subunit 2; gb2; Gm425; Gpr51; GPRC3B; G-protein coupled receptor 51; HG20; HRIHFB2099; MGC119386; MGC119388; MGC119389; ortholog of human G protein-coupled receptor 51 GPR51; RP23-337N2.1
Common Name GABBR2
Gene Symbol GABBR2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.