Invitrogen™ Human G6B (aa 181-233) Control Fragment Recombinant Protein

Product Code. 30199639

Brand: Invitrogen™ RP108912

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140079 (PA5-140079. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G6B is a member of the immunoglobulin (Ig) superfamily with 241 amino acids and is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been reported. RT-PCR, Western blot, and flow cytometric analyses suggest that G6B is usually expressed on platelets and cross linking of G6B inhibits platelet aggregation and activation in a calcium-independent manner by agonists such as ADP and collagen-related peptide. G6B is an inhibitory surface receptor on platelets and may be an antithrombotic drug target. Isoform B is a putative inhibitory receptor. Isoform A may be its activating counterpart. It is known to bind to heparin. G6B is usually expressed in a restricted set of hematopoietic cell lines like K562, Molt4 and Jurkat and not detected in the cell lines like U937, Raji, Tk, HeLa, NKL, NK62 and YT.

Specifications

• Accession Number: O95866
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80739
• Name: Human G6B (aa 181-233) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU023871; C6orf25; chromosome 6 open reading frame 25; DADB-110M10.2; G6b; G6B-B; immunoglobulin receptor; immunoreceptor tyrosine-based inhibitory motif (ITIM) containing platelet receptor; Immunoreceptor tyrosine-based inhibitory motif (ITIM)-containing platelet receptor; ITIM-receptor G6b-B; Megakaryocyte and platelet inhibitory receptor G6b; MPIG6B; NG31; Protein G6b
• Common Name: G6B
• Gene Symbol: Mpig6b
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: APLVKTEPQRPVKEEEPKIPGDLDQEPSLLYADLDHLALSRPRRLSTADPADA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining