Invitrogen™ Human G2E3 (aa 572-692) Control Fragment Recombinant Protein

Product Code. 30196218

Brand: Invitrogen™ RP88865

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51610 (PA5-51610. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Essential in early embryonic development to prevent apoptotic death.

Specifications

• Accession Number: Q7L622
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55632
• Name: Human G2E3 (aa 572-692) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6030408C04Rik; 9030416F18; AW046379; D930034K21Rik; G2/M phase-specific E3 ubiquitin-protein ligase; G2/M phase-specific HECT-type E3 ubiquitin transferase; G2/M-phase specific E3 ubiquitin ligase; G2/M-phase specific E3 ubiquitin protein ligase; G2e3; hypothetical protein LOC508575; KIAA1333; mKIAA1333; PHD finger protein 7 B; PHF7B; RGD1310263
• Common Name: G2E3
• Gene Symbol: G2E3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IQAYPEAFCSILCHKPESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining