Invitrogen™ Human FZD5 (aa 127-170) Control Fragment Recombinant Protein

Product Code. 30180836

Brand: Invitrogen™ RP98527

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.

Specifications

• Accession Number: Q13467
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7855
• Name: Human FZD5 (aa 127-170) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C2orf31; DKFZp434E2135; frizzled 5, seven transmembrane spanning receptor; frizzled class receptor 5; frizzled family receptor 5; frizzled-5; Fz5; Fz-5; Fzd5; Fzd-5; FzE5; HFZ5; MGC129692; seven-transmembrane receptor frizzled-5; Wnt receptor
• Common Name: FZD5
• Gene Symbol: FZD5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining