Invitrogen™ Human FZD4 (aa 130-215) Control Fragment Recombinant Protein

Product Code. 30201002

Brand: Invitrogen™ RP105592

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FZD4 is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. Frizzled 4 is widely expressed, particularly in heart, skeletal muscle, ovary, and fetal kidney. Transcripts have also been identified in liver, kidney, pancreas, spleen, and fetal lung, and in smaller amounts in placenta, adult lung, prostate, testis, colon, and fetal brain.

Specifications

• Accession Number: Q9ULV1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8322
• Name: Human FZD4 (aa 130-215) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CD344; CD344 antigen; EVR1; FEVR; frizzled 4, seven transmembrane spanning receptor; frizzled class receptor 4; frizzled family receptor 4; frizzled homolog 4; frizzled homolog 4 (Drosophila); frizzled receptor 4; frizzled-4; Fz4; Fz-4; Fzd4; FZD4S; FzE4; GPCR; hFz4; mFz4; MGC34390; rFz4; WNT receptor frizzled-4
• Common Name: FZD4
• Gene Symbol: FZD4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining