Invitrogen™ Human FZD10 (aa 465-498) Control Fragment Recombinant Protein

Product Code. 30209545

Brand: Invitrogen™ RP90855

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FZD10/Frizzled-10 is a 581 amino acid protein belonging to the G-protein coupled receptor Fz/Smo family and containing a signal peptide, a cysteine-rich domain in the N-terminal, seven transmembrane domains and a C-terminal PDZ domain-binding motif. It is involved in transduction, intercellular transmission of polarity information during tissue morphogenesis in differentiated tissues and as a receptor for Wnt proteins. FZD10 is expressed highly in placenta, fetal kidney, fetal lung, brain cerebellum, cerebral cortex, medulla and spinal cord with very low levels in total brain, frontal lobe, temporal lobe, putamen, adult brain, heart, lung and skeletal muscle.

Specifications

• Accession Number: Q9ULW2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11211
• Name: Human FZD10 (aa 465-498) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CD350; CD350 antigen; frizzled 10, seven transmembrane spanning receptor; frizzled class receptor 10; frizzled family receptor 10; frizzled homolog 10; frizzled homolog 10 (Drosophila); frizzled homolog 10, pseudogene 1; frizzled-10; Fz10; Fz-10; Fzd10; Fzd10-ps1; FzE7; hFz10
• Common Name: FZD10
• Gene Symbol: FZD10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ERLNMDYWKILAAQHKCKMNNQTKTLDCLMAASI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining