missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198446

Invitrogen™ Human Fyn (aa 225-265) Control Fragment Recombinant Protein

Product Code. 30198446
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198446

Brand: Invitrogen™ RP105284

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FYN is a SRC-related kinase expressed in brain, skeletal muscle and adipose tissues. Fyn functions in a large number of pathways and has been shown to play a role in memory. FYN is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P06241
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2534
Name Human Fyn (aa 225-265) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI448320; AW552119; C syn protooncogene; c-syn protooncogene; EC 2.7.10.2; Fyn; fyn {ECO:0000312; FYN oncogene related to SRC, FGR, YES; Fyn proto-oncogene; FYN proto-oncogene, Src family tyrosine kinase; kinase Fyn; MGC45350; OKT3-induced calcium influx regulator; OTTHUMP00000017916; OTTHUMP00000017917; P59 p59-Fyn; p59-Fyn; Proto-oncogene c-Fyn; Protooncogene Syn; proto-oncogene Syn; proto-oncogene tyrosine-protein kinase Fyn; RGD:2641}; RP1-66H14.1; SLK; Src Kinase p59; Src like kinase; src/yes-related novel; src-like kinase; SYN; tyrosine kinase p59fyn(T); tyrosine-protein kinase Fyn
Common Name Fyn
Gene Symbol Fyn
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.