Invitrogen™ Human FSTL1 (aa 232-301) Control Fragment Recombinant Protein

Product Code. 30209434

Brand: Invitrogen™ RP108352

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Follistatin-like protein 1 (FSTL1) is a widely-expressed, extracellular glycoprotein that is homologously grouped into the osteonectin (BM-40/SPARC) family of secreted proteins based on its possession of both a follistatin-like and extracellular calcium-binding domain. Initially identified as a TGF-beta-inducible protein in a cloned mouse osteoblast cell line, FSTL1 has since been implicated in an array of cell-type-specific functions, such as the regulation of proliferation, differentiation, apoptosis and migration, as well as a number of biological processes, including embryonic development, inflammatory response, angiogenesis, tumorigenesis, and immune disease pathogenesis. Highly conserved across mammalian species and widely expressed in human tissues, FSTL1 can be upregulated through signaling mediators of the innate immune system,such as TLR4 agonists and the arthritogenic cytokine IL-1beta via NFkappaB pathways, to stimulate the expression and secretion of pro-inflammatory cytokines, including TNF-alpha, IL-1beta, IL-6 and IL-8. While cells of mesenchymal lineage are capable of FSTL1 production, FSTL1 expression is notably absent from cells of hematopoietic lineage under normal physiological conditions. Macrophages and monocytes are, however, capable of taking up FSTL1 at sites of inflammation where FSTL1 stimulation can cause the expression of caspase-1 and its resultant enzymatic cleavage of active IL-1beta from pro-IL-1beta. Whereas the overexpression of FSTL1 has been noted as a substantial contributor to the progression of immune diseases like rheumatoid arthritis (RA) and osteoarthritis (OA), diminished FSTL1 serum levels have been identified as playing a significant part in both ovarian and endometrial carcinogenesis, where it directly affects cell proliferation, migration and invasion.

Specifications

• Accession Number: Q12841
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11167
• Name: Human FSTL1 (aa 232-301) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI316791; AW107808; FLJ50214; FLJ52277; follistatin like 1; follistatin-like 1; follistatin-like protein 1; Follistatin-related protein 1; FRP; FSL1; Fstl; FSTL1; MIR198; OCC1; OCC-1; TGF-beta-inducible protein TSC-36; tsc36; TSC-36
• Common Name: FSTL1
• Gene Symbol: Fstl1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKTK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining