Invitrogen™ Human FSBP (aa 197-299) Control Fragment Recombinant Protein

Product Code. 30202851

Brand: Invitrogen™ RP105760

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82896 (PA5-82896. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Fibrinogen silencer-binding protein, Function: Transcriptional repressor that down-regulates the expression of the fibrinogen gamma chain. Represses transcription of GSK3B gene promoter via its interaction with APBA1. Subunit structure: Interacts with APBA1 (via PDZ 1 and 2 domains). Subcellular location: Nucleus. Tissue specificity: Expressed in multiple tissues including brain. Miscellaneous: Intragenic, in the second intron of RAB54B gene.

Specifications

• Accession Number: O95073
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 100861412
• Name: Human FSBP (aa 197-299) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: fibrinogen silencer binding protein; fibrinogen silencer-binding protein; fibrinogen silencer-binding protein-like; FSBP; LOC102550523
• Common Name: FSBP
• Gene Symbol: FSBP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining