missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212270

Invitrogen™ Human FRS3 (aa 297-391) Control Fragment Recombinant Protein

Product Code. 30212270
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212270

Brand: Invitrogen™ RP94865

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56385 (PA5-56385. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FRS3 (fibroblast growth factor receptor substrate 3), also known as FRS2B (FRS2-beta), is a 492 amino acid lipid-anchor adapter protein that contains one IRS-type PTB domain. Colocalizing to neural tissues with Tuj1, FRS3 functions as a feedback inhibitor of EGFR family members by preventing heterodimer formation between EGFR and ErbB2, thereby acting as a potential tumor suppressor. FRS3 is phosphorylated upon stimulation by FGF-2 or NGF and, acting as an adapter protein, links c-Fgr and NGF receptors to downstream signaling pathways. Interfering with the phosphorylation and nuclear translocation of ERK-2, FRS3 down-regulates ERK-2 expression. FRS3 likely interacts directly with GRB2, SH-PTP2, Flg, and Trk A, and may be involved in MAP kinase activation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43559
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10817
Name Human FRS3 (aa 297-391) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930417B13Rik; AI449674; FGFR substrate 3; FGFR-signaling adaptor SNT2; Fibroblast growth factor receptor substrate 3; FRS2B; Frs2beta; FRS2-beta; FRS3; Snt2; SNT-2; Suc1-associated neurotrophic factor target 2; suc1-associated neurotrophic factor target 2 (FGFR signalling adaptor); testicular tissue protein Li 71
Common Name FRS3
Gene Symbol FRS3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GAGWRLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSRDGLTPSSNGFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.