Invitrogen™ Human FOXR2 (aa 8-80) Control Fragment Recombinant Protein

Product Code. 30205199

Brand: Invitrogen™ RP105069

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84337 (PA5-84337. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Forkhead-box (FOX) transcription factors are implicated in carcinogenesis through gene amplification, retroviral integration, or chromosomal translocation. Human FOXN6 mRNA was expressed in breast cancer cell line and primary breast cancer.

Specifications

• Accession Number: Q6PJQ5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 139628
• Name: Human FOXR2 (aa 8-80) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EG436240; Forkhead box protein N6; forkhead box protein R2; forkhead box R2; Foxn6; Foxr2
• Common Name: FOXR2
• Gene Symbol: FOXR2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CEFWYSLHGQVPGLLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRRPSPDGDGPPCEPNLWM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining