Invitrogen™ Human FOXO4 (aa 309-400) Control Fragment Recombinant Protein

Product Code. 30208404

Brand: Invitrogen™ RP104704

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FOXO4 (Forkhead box O4) is encoded by the FOXO4 gene located on the X chromosome. It is also known as AFX1 or MLLT7 (Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog, Translocated To, 7) and is a member of the O class of forkhead/ winged helix family of transcription factors along with FOXO1, FOXO3 and FOXO6. FOXO4 is abundantly expressed in skeletal muscle and adipose tissue. FOXO4 binds to the Insulin Responsive Element (IRE) and activates downstream targets of Insulin/IGF1 signaling such as IGFBP1. However, the activation of another downstream target of the Insulin/IGF1 pathway, Akt, leads to phosphorylation of FOXO4 on specific Ser/Thr residues. This phosphorylation mediates binding of FOXO4 to 14-3-3 and eventual exit of FOXO4 from the nucleus.

Specifications

• Accession Number: P98177
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4303
• Name: Human FOXO4 (aa 309-400) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AFX; Af x 1; Afxh; AFXzeta; Fkhr3; Fork head domain transcription factor AF x 1; forkhead box O4; forkhead box protein O4; forkhead protein; FOXO4; FOXO4b; MGC120490; MLLT7; myeloid/lymphoid or mixed lineage-leukemia translocation to 7 homolog; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 7; OTTHUMP00000023497; RGD1561201
• Common Name: FOXO4
• Gene Symbol: FOXO4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining