missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FOXO1 (aa 466-614) Control Fragment Recombinant Protein

Product Code. 30206618
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206618

Brand: Invitrogen™ RP94753

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FOXO1 (FKHR, ForKHead Box 01) is a member in a subfamily of the forkhead homeotic gene family of transcription factors. Recent experiments have shown that FOXO1 can act as either a coactivator or a corepressor of nuclear receptor activity that is mediated through the LXXLL motif found in the carboxyl terminal region of the FKHR protein. Association of FOXO1 with PAX3 has been implicated in alveolar rhabdomyosarcoma. Recent studies link the anti-tumor activity of FOXO1, the process of autophagy and myogenic growth and differentiation. FOXO1 is the main target of insulin signaling that regulated the metabolic homeostasis in response to oxidative stress. FOXO1 binds to the insulin response element (IRE) with consensus sequence 5'-TT[G/A]TTTTG-3' and the related Daf-16 family binding element (DBE) with consensus sequence 5'- TT[G/A]TTTAC-3'. FOXO1 is a regulator of redox balance, osteoblast numbers and controls bone mass. Further, FOXO1 orchestrates the endocrine function of the skeleton in regulating glucose metabolism, and suppresses the transcriptional activity of RUNX2, an upstream activator of osteocalcin/BGLAP. In hepatocytes, FOXO1 promotes gluconeogenesis by acting together with PPARGC1A to activate the expression of genes such as IGFBP1, G6PC and PPCK1. FOXO1 is an important regulator of cell death acting downstream of CDK1, PKB/AKT1 and SKT4/MST1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q12778
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2308
Name Human FOXO1 (aa 466-614) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Afxh; AI876417; FKH1; FKHR; Fkhr1; forkhead box O1; forkhead box O1 a; forkhead box O1a; forkhead box O1A (rhabdomyosarcoma); forkhead box protein O1; forkhead box protein O1; LOW QUALITY PROTEIN: forkhead box protein O1; forkhead box protein O1A; Forkhead box protein O1-A; Forkhead in rhabdomyosarcoma; forkhead protein 1; forkhead protein FKHR; forkhead, Drosophila, homolog of, in rhabdomyosarcoma; fox family transcription factor FoxO1a0.1; FOX01A; foxhead box protein O1-A; foxo1; FOXO1A; FoxO1a0.1; member of FKHR-subclass forkhead/winged helix family; zgc:153388
Common Name FOXO1
Gene Symbol FOXO1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.