Invitrogen™ Human FOXN2 (aa 164-306) Control Fragment Recombinant Protein

Product Code. 30200321

Brand: Invitrogen™ RP100747

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51943 (PA5-51943. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a forkhead domain binding protein and may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat.

Specifications

• Accession Number: P32314
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3344
• Name: Human FOXN2 (aa 164-306) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3230402J05Rik; 6030465J18Rik; Fkh19; forkhead box N1; forkhead box N2; forkhead box protein N2; forkhead homolog 19; Foxn1; FOXN2; HTLF; Human T-cell leukemia virus enhancer factor; RGD1562291
• Common Name: FOXN2
• Gene Symbol: FOXN2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining