Invitrogen™ Human FOXC2 (aa 429-500) Control Fragment Recombinant Protein

Product Code. 30193906

Brand: Invitrogen™ RP106692

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84284 (PA5-84284. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Forkhead box protein C2 (FOXC2) is a transciptional activator and is characterized by a distinct DNA-binding forkhead domain. FOXC2 may be involved in the formation of special mesenchymal tissues. Mutations affecting the gene can cause lymphedema-distichiasis (LYD).

Specifications

• Accession Number: Q99958
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2303
• Name: Human FOXC2 (aa 429-500) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BF-3; brain factor 3; Fkh14; Fkhl14; forkhead box C2; forkhead box C2 (MFH-1 mesenchyme forkhead 1); forkhead box C2 (MFH-1, mesenchyme forkhead 1); forkhead box protein C2; forkhead homolog 14; forkhead, Drosophila, homolog-like 14; forkhead-related protein FKHL14; FOXC2; Hfhbf3; HFH-BF-3; LD; mesenchyme fork head protein 1; mesenchyme forkhead 1; MFH1; MFH-1; MFH-1 protein; MFH-1,mesenchyme forkhead 1; Transcription factor FKH-14
• Common Name: FOXC2
• Gene Symbol: FOXC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining