Invitrogen™ Human FOXC1 (aa 497-553) Control Fragment Recombinant Protein

Product Code. 30181035

Brand: Invitrogen™ RP98335

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FOXC1 is a protein belonging to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this protein is not known, however, it plays a role in the regulation of FGF19-FGFR4-MAPK pathway to promote both the development and maintenance of anterior segment structures within the eye. Mutations in this gene cause various glaucoma, iridogoniodysgenesis anomaly, Peters anomaly that includes central corneal leukoma, absence of the posterior corneal stroma and Descemetmembrane and Axenfeld-Rieger anomaly characterized by posterior corneal embryotoxon, iris adhesion to the Schwalbe line, hypertelorism, hypoplasia of the malar bones, congenital absence of some teeth and mental retardation.

Specifications

• Accession Number: Q12948
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2296
• Name: Human FOXC1 (aa 497-553) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ARA; ch; congenital hydrocephalus; Fkh1; fkh-1; Fkhl7; forkhead box C1; forkhead box C1 protein; forkhead box protein C1; forkhead, drosophila, homolog-like 7; forkhead/winged helix-like transcription factor 7; forkhead-related activator 3; forkhead-related protein FKHL7; Forkhead-related transcription factor 3; Foxc1; FREAC3; FREAC-3; frkhda; HGNC:3800; IGDA; IHG1; IRID1; Mesoderm/mesenchyme forkhead 1; Mf1; MF-1; Mf4; myeloid factor-delta; RIEG3; Transcription factor FKH-1
• Common Name: FOXC1
• Gene Symbol: FOXC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining