Invitrogen™ Human FOXA3 (aa 2-64) Control Fragment Recombinant Protein

Product Code. 30212543

Brand: Invitrogen™ RP106500

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FOXA3 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.

Specifications

• Accession Number: P55318
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3171
• Name: Human FOXA3 (aa 2-64) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FKHH3; Fork head-related protein FKH H3; forkhead box A3; forkhead box protein A3; Foxa3; hepatocyte nuclear factor 3 gamma (winged helix transcription factor); hepatocyte nuclear factor 3, gamma; hepatocyte nuclear factor 3-gamma; HNF3G; HNF-3 G; HNF-3-gamma; Tcf3g; Tcf-3 g; Transcription factor 3 G
• Common Name: FOXA3
• Gene Symbol: FOXA3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining