missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210455

Invitrogen™ Human FosB (aa 264-314) Control Fragment Recombinant Protein

Product Code. 30210455
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210455

Brand: Invitrogen™ RP106562

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

c-FOS is a nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. It has a critical function in regulating the development of cells destined to form and maintain the skeleton, and is thought to have an important role in signal transduction, cell proliferation and differentiation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P53539
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2354
Name Human FosB (aa 264-314) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias activator protein 1; AP-1; DKFZp686C0818; FBJ murine osteosarcoma viral oncogene homolog B; FBJ murine osteosarcoma viral oncogene-like protein B; FBJ osteosarcoma oncogene B; FBJ osteosarcoma viral oncogene isoform deltaFosb-2; fos b; FOSB; FosB proto-oncogene, AP-1 trancription factor subunit; FosB proto-oncogene, AP-1 transcription factor subunit; fra-2; G0/G1 switch regulatory protein 3; G0S3; GOS3; GOSB; LOW QUALITY PROTEIN: protein fosB; MGC42291; oncogene FOS-B; protein fosB; zgc:92354
Common Name FosB
Gene Symbol Fosb
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.