Invitrogen™ Human Folliculin (aa 452-570) Control Fragment Recombinant Protein

Product Code. 30196522

Brand: Invitrogen™ RP93335

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55971 (PA5-55971. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a mitochondrial protein that is characterized by a poly-proline rich region. A chicken homolog of this protein promotes mitochondrial fission and the mouse homolog protects cells from oxidative stress. A related pseudogene of this gene is found on chromosome X.

Specifications

• Accession Number: Q8NFG4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 201163
• Name: Human Folliculin (aa 452-570) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU014660; B430214A04Rik; BHD; BHD skin lesion fibrofolliculoma protein; birt-Hogg-Dube syndrome protein; Birt-Hogg-Dube syndrome protein homolog; FLCL; Flcn; Folliculin
• Common Name: Folliculin
• Gene Symbol: FLCN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLMSTVR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining