Invitrogen™ Human FNTA (aa 58-125) Control Fragment Recombinant Protein

Product Code. 30199475

Brand: Invitrogen™ RP101897

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53858 (PA5-53858. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FNTA (Farnesyltransferase, CAAX box; alphaCAAX farnesyltransferase alpha subunit, FPTA, FTase-alpha, GGTase-I-alpha, Protein farnesyl transferase/ geranyl geranyl transferase type I alpha subunit(PGGT1A), Ras proteins prenyl transferase alpha, Type I protein geranyl-geranyl transferase alpha subunit) is located locus 8p11 (human). Prenylation is a common intracellular posttranslational protein modification catalyzed by prenyltransferases. The best characterized among these prenyltransferases is the CAAX farnesyl transferase (2. 5. 1. 21), which is alpha-beta heterodimeric enzyme. It catalyzes the attachment of a farnesyl group from farnesyl phosphate to cysteine residues at the fourth position from the C terminus of proteins that end in the CAAX box. FNTA or the alpha subunit of farnesyl transferase is shared by the geranyl-geranyl protein transferases. Apart from transfer of farnesyl and geranyl groups to proteins, FNTA has been proposed to regulate intracellular signaling pathways involving p21ras. Reports have shown that FNTA interacts with TGF-beta and activin-type I receptors.

Specifications

• Accession Number: P49354
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2339
• Name: Human FNTA (aa 58-125) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CAAX farnesyltransferase subunit alpha; farnesyl-protein transferase alpha-subunit; farnesyltransferase, CAAX box, alpha; Farnesyltransferase, subunit alpha; Fnta; FPTA; FTA; FTase-alpha; GGTase-I-alpha; PFAS; PGGT1A; Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; protein prenyltransferase alpha subunit repeat containing 2; PTAR2; Ras proteins prenyltransferase subunit alpha; type I protein geranyl-geranyltransferase alpha subunit; type I protein geranyl-geranyltransferase subunit alpha
• Common Name: FNTA
• Gene Symbol: FNTA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining