missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209760

Invitrogen™ Human FNIP2 (aa 677-767) Control Fragment Recombinant Protein

Product Code. 30209760
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209760

Brand: Invitrogen™ RP100176

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111162 (PA5-111162. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FNIP2 is the second protein found to interact with folliculin, the product of the Birt-Hogg-Dube (BHD) gene. Folliculin is thought to act as a tumor suppressor as mutations or loss of heterozygosity in this gene are associated with BHD syndrome-related renal tumors. Folliculin and FNIP1, a protein that shares 49% identity to FNIP2, bind to AMPK, an important energy sensor in cells that negatively regulates the mammalian target of rapamycin (mTOR), a protein that is thought to be the master switch for cell growth and proliferation. FNIP1 and FNIP2 are able to form homo- and heteromeric multimers, suggesting these proteins may have a functional relationship.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9P278
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57600
Name Human FNIP2 (aa 677-767) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D630023B12Rik; FNIP1-like protein; Fnip2; Fnipl; folliculin interacting protein 2; folliculin-interacting protein 2; KIAA1450; MAPO1; mKIAA1450; O6-methylguanine-induced apoptosis 1 protein; RGD1562174
Common Name FNIP2
Gene Symbol FNIP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MDQQAVCELLKVEMPTRLPDRSVAWPCPDRHLREKPSLEKVTFQIGSFASPESDFESRMKKMEERVKACGPSLEASEAADVAQDPQVSRSP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.