Invitrogen™ Human FNDC4 (aa 47-100) Control Fragment Recombinant Protein

Product Code. 30212405

Brand: Invitrogen™ RP103724

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64124 (PA5-64124. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as an anti-inflammatory factor in the intestine and colon. Binds to and acts on macrophages to downregulate pro-inflammatory gene expression. Affects key macrophage functions, including phagocytosis, by downregulating many key pathways for macrophage activation, partly via by STAT3 activation and signaling. May be required to dampen the immunological response in colitis.

Specifications

• Accession Number: Q9H6D8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64838
• Name: Human FNDC4 (aa 47-100) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810430J06Rik; 6330410H20Rik; AB030187; AI838506; AW487863; fibronectin type III domain containing 4; fibronectin type III domain-containing protein 4; fibronectin type III repeat containing protein 1; fibronectin type III repeat-containing protein 1; Fndc4; Fnmp1; FRCP1; UNQ6389/PRO21134
• Common Name: FNDC4
• Gene Symbol: FNDC4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining