Invitrogen™ Human FN3KRP (aa 83-178) Control Fragment Recombinant Protein

Product Code. 30206634

Brand: Invitrogen™ RP103613

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66002 (PA5-66002, PA5-64249 (PA5-64249. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FN3KRP and FN3K.

Specifications

• Accession Number: Q9HA64
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79672
• Name: Human FN3KRP (aa 83-178) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FN3KL; FN3K-related protein; Fn3krp; FN3K-RP; fructosamine 3 kinase related protein; fructosamine 3-kinase-related protein; fructosamine-3-kinase-related protein; Ketosamine-3-kinase; ortholog of human fructosamine-3-kinase-related protein FN3KRP; Protein-psicosamine 3-kinase FN3KRP; RGD1304570; testis secretory sperm-binding protein Li 211 A
• Common Name: FN3KRP
• Gene Symbol: FN3KRP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining