missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196190

Invitrogen™ Human FMNL3 (aa 845-969) Control Fragment Recombinant Protein

Product Code. 30196190
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196190

Brand: Invitrogen™ RP102030

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51720 (PA5-51720. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FMNL3, also known as Formin-like protein 3, is a 1028 amino acid containing protein involved in immunity or defense. This developmental protein is implicated in polarity control, invasion, migration, or metastasis through regulation of the Rho-related signaling pathway. It belongs to the formin homology family and contains a FH2 (formin homology 2) domain and a GBD/FH3 (Rho GTPase-binding/formin homology 3) domain and has high sequence identity to the mouse Wbp3 protein. Two different isoforms have been described. Itis suspectedbe involved in gastric cancer.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IVF7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 91010
Name Human FMNL3 (aa 845-969) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2700073B04Rik; FBP11; FHOD3; FMNL3; Formin homology 2 domain-containing protein 3; formin like 3; formin-like 3; formin-like 3 protein; formin-like protein 3; Frl2; KIAA2014; mKIAA2014; WBP3; WBP-3; WW domain binding protein 3; WW domain-binding protein 3
Common Name FMNL3
Gene Symbol FMNL3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.