Invitrogen™ Human FMNL2 (aa 393-516) Control Fragment Recombinant Protein

Product Code. 30199250

Brand: Invitrogen™ RP88596

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52148 (PA5-52148. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Formin-like protein 2 is a cytoplasmic phosphoprotein belonging to the formin homology domain containing protein family and has a DAD (diaphanous autoregulatory domain), FH2 (formin homology 2) domain, and GBD/FH3 (Rho GTPase-binding/formin homology 3) domain. The exact function of FMNL2 is yet to be known but reports suggest that it may have a role in the Wnt signaling pathway. Formin-related proteins are also known to play an important role in morphogenesis, cytokinesis and cell polarity. Several alternatively spliced transcript variants have been described but their full-length nature is not yet determined. It is also known to be associated with a diffuse-type gastric cancer, breast cancer, chondrosarcoma, melanoma, and glioblastoma. FMNL2 might be implicated in polarity control, invasion, migration or metastasis through actin filament nucleation and may be regulated by Rho family GTPase.

Specifications

• Accession Number: Q96PY5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 114793
• Name: Human FMNL2 (aa 393-516) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5430425K04Rik; FHOD2; FMNL2; formin homology 2 domain containing 2; formin homology 2 domain-containing protein 2; formin like 2; formin-like 2; formin-like domain containing protein MAN; formin-like protein 2; Kiaa1902; Man; protein Man
• Common Name: FMNL2
• Gene Symbol: FMNL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining