missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194748

Invitrogen™ Human FMN2 (aa 506-616) Control Fragment Recombinant Protein

Product Code. 30194748
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194748

Brand: Invitrogen™ RP106300

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65632 (PA5-65632. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FMN2, a novel formin homology protein of the cappuccino subfamily, is highly conserved between evolutionarily diverse vertebrates. FMN2 bears a high degree of similarity to formin-1 which is the founding member of formin homology proteins. FMN2 plays a crucial role in maintenance of the meiotic spindle. The protein is widely expressed in human fetal brain, adult whole brain, hypothalamus, retina, pancreatic islet and germinal-center B cells. Pathological role of the protein is identified in various tumors like parathyloid tumor, glioblastoma, retinoblastoma and chondrosarcoma. FMN2 mutations are often a cause of unexplained infertility in women. The gene encoding for human FMN2 is localized in the chromosomal region 1q43.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NZ56
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56776
Name Human FMN2 (aa 506-616) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AU024104; FMN2; formin 2; formin-2; RP11-90L13.1
Common Name FMN2
Gene Symbol FMN2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GVASDSGGGVSPALAAKASGAPAAADGFQNVFTGRTLLEKLFSQQENGPPEEAEKFCSRIIAMGLLLPFSDCFREPCNQNAQTNAASFDQDQLYTWAAVSQPTHSLDYSEG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.