Invitrogen™ Human FMN1 (aa 249-372) Control Fragment Recombinant Protein

Product Code. 30212583

Brand: Invitrogen™ RP88599

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (41%), Rat (41%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52149 (PA5-52149. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in the formation of adherens junction and the polymerization of linear actin cables.

Specifications

• Accession Number: Q68DA7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 342184
• Name: Human FMN1 (aa 249-372) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FMN; Fmn1; formin (limb deformity); formin 1; formin-1; Ld; limb deformity protein; Limb deformity protein homolog; RGD1306349; RGD1310100
• Common Name: FMN1
• Gene Symbol: Fmn1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GFGSFETAFKDTGLGREVLPPDCSSTEAGGDGIRRPPSGLEHQQTGLSESHQDPEKHPEAEKDEMEKPAKRTCKQKPVSKVVAKVQDLSSQVQRVVKTHSKGKETIAIRPAAHAEFVPKADLLT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining