Invitrogen™ Human FLRT1 (aa 338-387) Control Fragment Recombinant Protein

Product Code. 30201629

Brand: Invitrogen™ RP101256

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84211 (PA5-84211. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the fibronectin leucine rich transmembrane protein (FLRT) family. The family members may function in cell adhesion and/or receptor signalling. Their protein structures resemble small leucine-rich proteoglycans found in the extracellular matrix. The encoded protein shares sequence similarity with two other family members, FLRT2 and FLRT3. This gene is expressed in kidney and brain.

Specifications

• Accession Number: Q9NZU1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23769
• Name: Human FLRT1 (aa 338-387) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW742165; D630040I23Rik; Fibronectin leucine rich transmembrane protein 1; fibronectin leucine rich transmembrane protein 3; fibronectin-like domain-containing leucine-rich transmembrane protein 1; Flrt1; Leucine-rich repeat transmembrane protein FLRT1; RGD1565152; SPG68; UNQ752/PRO1483
• Common Name: FLRT1
• Gene Symbol: FLRT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining