missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FLRT1 (aa 338-387) Control Fragment Recombinant Protein

Product Code. 30201629
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201629

Brand: Invitrogen™ RP101256

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84211 (PA5-84211. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the fibronectin leucine rich transmembrane protein (FLRT) family. The family members may function in cell adhesion and/or receptor signalling. Their protein structures resemble small leucine-rich proteoglycans found in the extracellular matrix. The encoded protein shares sequence similarity with two other family members, FLRT2 and FLRT3. This gene is expressed in kidney and brain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NZU1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23769
Name Human FLRT1 (aa 338-387) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW742165; D630040I23Rik; Fibronectin leucine rich transmembrane protein 1; fibronectin leucine rich transmembrane protein 3; fibronectin-like domain-containing leucine-rich transmembrane protein 1; Flrt1; Leucine-rich repeat transmembrane protein FLRT1; RGD1565152; SPG68; UNQ752/PRO1483
Common Name FLRT1
Gene Symbol FLRT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.