Invitrogen™ Human Flavin reductase (aa 60-132) Control Fragment Recombinant Protein

Product Code. 30182266

Brand: Invitrogen™ RP98899

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83580 (PA5-83580. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The final step in heme metabolism in mammals is catalyzed by the cytosolic biliverdin reductase enzymes A and B (EC 1.3.1.24).

Specifications

• Accession Number: P30043
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 645
• Name: Human Flavin reductase (aa 60-132) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Biliverdin reductase B; biliverdin reductase B (flavin reductase (NADPH)); biliverdin-IX beta-reductase; BLVRB; BVRB; BVR-B; epididymis secretory protein Li 10; flavin reductase (NADPH); FLR; FR; GHBP; green heme-binding protein; HEL-S-10; NADPH; NADPH-dependent diaphorase; NADPH-flavin reductase; SDR43U1; short chain dehydrogenase/reductase family 43 U, member 1
• Common Name: Flavin reductase
• Gene Symbol: BLVRB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DVDKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining